DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT2G18360

DIOPT Version :10

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_565437.1 Gene:AT2G18360 / 816351 AraportID:AT2G18360 Length:313 Species:Arabidopsis thaliana


Alignment Length:159 Identity:35/159 - (22%)
Similarity:55/159 - (34%) Gaps:35/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   968 SNQYVVGLALFALGNICSAEMAPDL-APE------VERL------VQFRDPNIRKK----AALCS 1015
            |.|.|.|........:...:.:..| .||      .:||      .:||||::|:.    ..:..
plant   107 STQSVTGTQTLTTDEVSQTDSSQQLQCPESTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILD 171

  Fly  1016 TRIV-----RKVPDLVENFVNADASLLKEKHHGVLIRGVQLCYELCTINDEALEYFRTK-----C 1070
            ..|:     .|....|....:.||...:||.:|.::.|.::     .:|:........|     .
plant   172 VEIIFNERGSKGFGFVTFETSMDADRAREKLNGTIVEGRKI-----EVNNATARVMTNKKPVNPY 231

  Fly  1071 TEGLIKFLRDITNCAYQPE-YDVAGITDP 1098
            |.|.  .|..:....|.|| |.|.|...|
plant   232 TNGW--KLNPVVGAVYGPEFYAVTGFPYP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MenH 46..>165 CDD:440361
Abhydrolase_6 48..310 CDD:463673
AT2G18360NP_565437.1 MenH 60..309 CDD:440361 35/159 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.