DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and abhd6a

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_001339480.1 Gene:abhd6a / 799085 ZFINID:ZDB-GENE-090925-1 Length:339 Species:Danio rerio


Alignment Length:312 Identity:66/312 - (21%)
Similarity:122/312 - (39%) Gaps:53/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIDMPWGYVVGKWY-------GNRQVRP-ILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHG 83
            |:.|...|...:.|       ||...|| :|.|||:..:...|..::..|||::.::|:|:|||.
Zfish    45 RLGMQVDYAEYEGYRFCYSHRGNPGFRPSVLMLHGFSAHKDMWLGVVKFLPKNVHLICVDMPGHE 109

  Fly    84 YSSKLPEGIAYHFVDYLCVILRVMEEYRWQK--VSLMAHSMSAMLCFVFASLYPHRTDMLVSIDI 146
            .:|: ...:.|.....:..|.:.::.....|  ..|:..||...:..|:|:.:|..   |..:.:
Zfish   110 GTSR-TSAVDYSIEGQVKRINQFVKSIGLNKKPFHLIGTSMGGNVAGVYAARHPSE---LCGVTL 170

  Fly   147 VKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYT--EMEQVLYKGTDYSVELENCR 209
            :.....:.|::..::.:..|....:|       |...|....|  :||::| |...| |..:..:
Zfish   171 ICPAGLQYPTESKFVERLRELEKTQD-------RDGIPLIPSTPEQMEEML-KLCSY-VRFKIPK 226

  Fly   210 HILERNISRSTKFPAKFFF--------SRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSE 266
            .||:..:  ..:.|...|:        ....|...:...|            :.:.|..||.|..
Zfish   227 QILQGLV--DVRIPNNDFYHECFMELVGEKSRHSLHENMH------------LISTPLQVIWGKN 277

  Fly   267 SNYIDEQSDEVI-GILRENNPHFELHEVQGT-HHVHLNNAQGVAAVINPFIL 316
            ...:|.....|: |.:    |..::|.:... |.|.|...:..|.:|..||:
Zfish   278 DQVLDVSGASVLSGAV----PGCQVHLLDNCGHSVVLERPRKSAQLITDFII 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 60/286 (21%)
abhd6aXP_001339480.1 MhpC 52..324 CDD:223669 62/302 (21%)
Abhydrolase 71..>168 CDD:304388 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.