DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and ABHD8

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_078803.4 Gene:ABHD8 / 79575 HGNCID:23759 Length:439 Species:Homo sapiens


Alignment Length:307 Identity:60/307 - (19%)
Similarity:110/307 - (35%) Gaps:78/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LHGWLDNLGTWDKLLPLLPKHLG--VLCIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQ 113
            :||...:|..|.:.|....: ||  |:..||.|||.||......||.|......:..:.:.|..:
Human   181 IHGVGGSLAIWKEQLDFFVR-LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKK 244

  Fly   114 KVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKP--------PSQIDYLRKNIEGYIV 170
            :..|:.||.....|...|..||.....::.|:.......:|        |:.:.:.......:..
Human   245 RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSIFNMPTCVLHCLSPCLAWSF 309

  Fly   171 EDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRDGRCK 235
            ....||....:|         :|:|.:|..::|                :.|..:...|.    :
Human   310 LKAGFARQGAKE---------KQLLKEGNAFNV----------------SSFVLRAMMSG----Q 345

  Fly   236 YYTE----FHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDE------VIGILRENNPHFEL 290
            |:.|    :|      |||     .||..::.|....::..:.|:      ::..|:..:     
Human   346 YWPEGDEVYH------AEL-----TVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLID----- 394

  Fly   291 HEVQGTHHVHLNNAQGVAAVINPFILHHRPPHLENWTVDGTDETLPE 337
               :|:|.|.|...:.|..:::.|:|         |..:.:.:.|||
Human   395 ---EGSHMVMLECPETVNTLLHEFLL---------WEPEPSPKALPE 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 56/286 (20%)
ABHD8NP_078803.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..156
MhpC 156..416 CDD:223669 54/283 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.