DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and ephx3

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001072430.1 Gene:ephx3 / 779884 XenbaseID:XB-GENE-5900414 Length:367 Species:Xenopus tropicalis


Alignment Length:122 Identity:29/122 - (23%)
Similarity:55/122 - (45%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFVDYLCVILR 105
            |:::...:|.|||:.:|..:|...|.........:.|||.|.| .|..|..:..:.::.|...|:
 Frog    93 GDKRNPLMLLLHGFPENWYSWRYQLDEFSNGYRTVAIDLRGFG-GSDAPSRLEDYKMEILLQDLQ 156

  Fly   106 -VMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYL 161
             ::....:.:..|:.|.....|.:.||  ..|| ||:..:.::...:  |.:..||:
 Frog   157 DLIRGLGYSRCVLVGHDWGGTLAWTFA--VRHR-DMVTHLIVMNAPH--PSAFHDYV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 28/117 (24%)
ephx3NP_001072430.1 MhpC 80..359 CDD:223669 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.