DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Abhd14b

DIOPT Version :10

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_083907.3 Gene:Abhd14b / 76491 MGIID:1923741 Length:210 Species:Mus musculus


Alignment Length:150 Identity:39/150 - (26%)
Similarity:58/150 - (38%) Gaps:44/150 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQVRP---------ILALHG-------WLDNLGTWDKLLPLLPKHLG--VLCIDLPGHGYSSK-- 87
            |:.||         :|.|||       | .||||..:|     ...|  .:.|||||.|.|.:  
Mouse    21 RETRPGSGQPVRFSVLLLHGIRFSSETW-QNLGTLQRL-----AEAGYRAVAIDLPGLGRSKEAA 79

  Fly    88 LPEGIAYHFV-DYLCVILRVMEEYRWQKVSLMAHSMSAM--LCFV---------FASLYPHRTDM 140
            .|..|..... .:|..::..:|   .....:::.|:|.|  |.|:         |..:.|..||.
Mouse    80 APAPIGEPAPGSFLAAVVDTLE---LGPPVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDK 141

  Fly   141 LVSIDIVKTRYRKPPSQIDY 160
            :.::|....   |.|:.|.|
Mouse   142 INAVDYASV---KTPALIVY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MenH 46..>165 CDD:440361 37/146 (25%)
Abhydrolase_6 48..310 CDD:463673 35/135 (26%)
Abhd14bNP_083907.3 MenH 7..209 CDD:440361 38/149 (26%)

Return to query results.
Submit another query.