DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Ephx3

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001028335.1 Gene:Ephx3 / 71932 MGIID:1919182 Length:424 Species:Mus musculus


Alignment Length:309 Identity:60/309 - (19%)
Similarity:109/309 - (35%) Gaps:103/309 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYS-SKLPEGIAYHFV 97
            :.|...:||..:  :|.|||:.:|..:|...|.....|..|:.:|:  .||| |..|:.:..:.:
Mouse   152 HYVSAGHGNGPL--MLFLHGFPENWFSWRYQLREFQSHFHVVAVDM--RGYSPSDAPKEVDCYTI 212

  Fly    98 DYLCVILRVMEEYR-------WQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPP 155
            |.|      :::.:       :.|..|::|...|.|.:.|:..||...:.:|..:       .||
Mouse   213 DLL------LDDIKDTILGLGYSKCILVSHDWGASLAWEFSIYYPSLVERMVVAN-------GPP 264

  Fly   156 SQI--DY--------LRKN----------------IEGYIVEDERFANSKRQEPPAYTYTEMEQV 194
            ..:  :|        .|.|                :..:.:..:.|.: ::...|..|.:|:|..
Mouse   265 MSVIQEYSIHHIGQIFRSNYMFLFQLPWLPEKLLSMSDFQILKDTFTH-RKNGIPGLTPSELEAF 328

  Fly   195 LYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRDGRC-----KYYTEFHTSPPFAAELARTI 254
            ||                              .||:.| |     .||.....:.|...:...| 
Mouse   329 LY------------------------------HFSQPG-CLTGPINYYRNVFRNFPLEPKKLST- 361

  Fly   255 KNVPYCVIKGSESNYIDEQSDEVIGILRENNPHF-----ELHEVQGTHH 298
               |..::.| |.::..:|     |::.....||     |.|.:.|:.|
Mouse   362 ---PTLLLWG-EKDFAFQQ-----GLVEAIGRHFVPGRLESHILPGSGH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 57/297 (19%)
Ephx3NP_001028335.1 Abhydrolase 139..>262 CDD:304388 29/126 (23%)
MhpC 144..415 CDD:223669 60/309 (19%)
Abhydrolase <341..424 CDD:304388 15/71 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.