DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Abhd14a

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_006511859.1 Gene:Abhd14a / 68644 MGIID:1915894 Length:273 Species:Mus musculus


Alignment Length:226 Identity:53/226 - (23%)
Similarity:82/226 - (36%) Gaps:74/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VVGKWYGN-----RQVRPI--------LALHGWLDNLGTWDKL--LPLLPKH-LGVLCIDLPGHG 83
            :.|...||     |:|.||        :.|||...|..||::|  |.||.:. ...:.|||||  
Mouse    48 LTGLTRGNSRIFYREVLPIQQARRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVAIDLPG-- 110

  Fly    84 YSSKLP--EGIAYHFVD--YLCVIL------------------------RVMEEYRWQKVSLMAH 120
               :.|  :|...|||.  .||::|                        ||.::.:.|...|::.
Mouse   111 ---EYPCIQGDPEHFVAPMRLCLLLFLGFGNSAPSEEVSTEAGRVELLERVFQDLQVQNTVLVSP 172

  Fly   121 SMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPA 185
            |:|......|.....|:....|.|        .|.|..:|.:          |:|...|  .|..
Mouse   173 SLSGSYALPFLMQNHHQLRGFVPI--------APTSTRNYAQ----------EQFGAVK--TPTL 217

  Fly   186 YTYTEMEQVLYKGTDYSVELENCRHILERNI 216
            ..|.|::..|.:.:     |:..||:...::
Mouse   218 ILYGELDHTLARES-----LQQLRHLPNHSV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 48/210 (23%)
Abhd14aXP_006511859.1 MhpC 51..272 CDD:223669 52/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.