DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Bphl

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_080788.1 Gene:Bphl / 68021 MGIID:1915271 Length:291 Species:Mus musculus


Alignment Length:338 Identity:62/338 - (18%)
Similarity:114/338 - (33%) Gaps:111/338 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PMDVRIDMPWGYVVGKWYGNRQVRPILALHG---WLDNLGTWDKLLPLLPKHLG----------- 73
            |:..||.:|....|.. :|.......:|::|   ....:|..:..:.|||..||           
Mouse    19 PLKSRICVPQAEPVAT-FGTAVTSAKVAVNGVHLHYQRVGEGEHAILLLPGMLGSGKTDFAPQLQ 82

  Fly    74 --------VLCIDLPGHGYSSKLPEGIAYHF--------VDYLCVILRVMEEYRWQKVSLMAHSM 122
                    ::..|..|:|||..........|        ||       :|:..::::|||:..|.
Mouse    83 SLNKKRFTLVAWDPRGYGYSRPPDRDFPRDFFERDAKDAVD-------LMKALQFKQVSLLGWSD 140

  Fly   123 SAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYLRKNI----EGYIV-EDERFAN----- 177
            ..:...:.|:.||                       .|:||.:    ..|:. ||.|...     
Mouse   141 GGITALIAAAKYP-----------------------SYIRKMVIWGANAYVTEEDSRIYQGIRDV 182

  Fly   178 ---SKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRDGR-CKYYT 238
               |::...|.       :.|| |.||..  :.|...:: .||:..:.|       :|. |:   
Mouse   183 SKWSEKARKPL-------EALY-GYDYLA--KTCEDWVD-GISQFKQLP-------EGNICR--- 226

  Fly   239 EFHTSPPFAAELARTIKNVPYCVIKGSESNYIDE-QSDEVIGILRENNPHFELHEVQGTHHVHLN 302
              |..|         :...|..::.|.:...:.. .:|.::..::.:..|.   ..:|.|::||.
Mouse   227 --HLLP---------LVQCPTLIVHGEKDPLVPRFHADFLLQHVKGSRLHL---MPEGKHNLHLR 277

  Fly   303 NAQGVAAVINPFI 315
            .|.....::..|:
Mouse   278 FADEFNRLVEDFL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 56/315 (18%)
BphlNP_080788.1 MhpC 44..291 CDD:223669 56/312 (18%)
Abhydrolase 58..259 CDD:304388 46/262 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.