DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Abhd6

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001317993.1 Gene:Abhd6 / 66082 MGIID:1913332 Length:336 Species:Mus musculus


Alignment Length:281 Identity:61/281 - (21%)
Similarity:98/281 - (34%) Gaps:113/281 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WYGNR----QVR---------------------PILALHGWLDNLGTWDKLLPLLPKHLGVLCID 78
            ||..|    |||                     .||.|||:..:...|..::..|||:|.::|:|
Mouse    40 WYWRRTLGMQVRYAHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVD 104

  Fly    79 LPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRW--------QKVSLMAHSMSAMLCFVFASLYP 135
            :|||       ||.....:|.|.::.:|...:::        :...|:..||...:..|:|:.||
Mouse   105 MPGH-------EGTTRSSLDDLSIVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYP 162

  Fly   136 ---------------HRTD--------------MLVSIDIVKT---------------RYRKPPS 156
                           :.||              .:..|.::.:               |: |.|.
Mouse   163 SDVCSLSLVCPAGLQYSTDNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRF-KVPQ 226

  Fly   157 QI------------DYLRKNIEGYIVEDERFA----NSKRQEPPAYTYTEMEQVL-YKGTDY--- 201
            ||            .:.||.....:.|..|::    ..|.:.|....:.:.:||| ..|.|.   
Mouse   227 QILQGLVDVRIPHNSFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAK 291

  Fly   202 -----SVE-LENCRH--ILER 214
                 .|| ||||.|  ::||
Mouse   292 SISNSQVEVLENCGHSVVMER 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 56/270 (21%)
Abhd6NP_001317993.1 MhpC 51..327 CDD:223669 56/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.