DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Ephx2

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_075225.1 Gene:Ephx2 / 65030 RGDID:620732 Length:554 Species:Rattus norvegicus


Alignment Length:219 Identity:48/219 - (21%)
Similarity:82/219 - (37%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DMPWGYVVGKWYGNRQVRP--------------ILALHGWLDNLGTWDKLLPLLPK-HLGVLCID 78
            |:..|||.        |:|              |...||:.::..:|...:|.|.: ...||.||
  Rat   234 DVSHGYVT--------VKPGIRLHFVEMGSGPAICLCHGFPESWFSWRYQIPALAQAGFRVLAID 290

  Fly    79 LPGHGYSSKLPEGIAYHFVDYLC-VILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLV 142
            :.|:|.||..|| |..:.::.|| .::..:.:....:...:.|..:.:|.:..|..:|.|...:.
  Rat   291 MKGYGDSSSPPE-IEEYAMELLCEEMVTFLNKLGIPQAVFIGHDWAGVLVWNMALFHPERVRAVA 354

  Fly   143 SIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELEN 207
            |::..........|.::.:|                   ..|.:.|.     ||.......|.| 
  Rat   355 SLNTPLMPPNPEVSPMEVIR-------------------SIPVFNYQ-----LYFQEPGVAEAE- 394

  Fly   208 CRHILERNISRSTKFPAKFFFSRD 231
                ||:|:||:.|   .||.:.|
  Rat   395 ----LEKNMSRTFK---SFFRTSD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 43/202 (21%)
Ephx2NP_075225.1 Phosphatase 1..224
HAD-SF-IA-v3 5..203 CDD:273662
Phosphate binding. /evidence=ECO:0000250|UniProtKB:P34913 123..124
HAD_like <142..205 CDD:304363
Epoxide hydrolase 233..554 48/219 (22%)
Abhydrolase 239..>379 CDD:304388 32/167 (19%)
Abhydrolase_1 257..530 CDD:278959 42/188 (22%)
Microbody targeting signal. /evidence=ECO:0000255 552..554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.