DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Abhd8

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_071864.2 Gene:Abhd8 / 64296 MGIID:1918946 Length:439 Species:Mus musculus


Alignment Length:301 Identity:64/301 - (21%)
Similarity:107/301 - (35%) Gaps:83/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LHGWLDNLGTWDKLLPLLPKHLG--VLCIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQ 113
            :||...:|..|.:.|....: ||  |:..||.|||.||......||.|......:..:...|..:
Mouse   173 IHGVGGSLAIWKEQLDFFVR-LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFTRYAKK 236

  Fly   114 KVSLMAHSMSAMLCFVFASLYP---HRTDM------------LVSIDIVKTRYRKPPSQIDYLRK 163
            :..|:.||.....|...|..||   |:..|            |.||      :..|...:..|..
Mouse   237 RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSLCSI------FNMPTCVLHCLSP 295

  Fly   164 NIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFF 228
            .:....:: ..||....:|         :|:|.:|..::|                :.|..:...
Mouse   296 CLAWSFLK-AGFARQGAKE---------KQLLKEGNAFNV----------------SSFVLRAMM 334

  Fly   229 SRDGRCKYYTE----FHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDE------VIGILRE 283
            |.    :|:.|    :|      |||     .||..::.|....::..:.|:      ::..|: 
Mouse   335 SG----QYWPEGDEVYH------AEL-----TVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLK- 383

  Fly   284 NNPHFELHEVQGTHHVHLNNAQGVAAVINPFILHHRPPHLE 324
                  |.| :|:|.|.|...:.|..:::.|:|....|..|
Mouse   384 ------LIE-EGSHMVMLECPETVNTLLHEFLLWEPEPEAE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 62/293 (21%)
Abhd8NP_071864.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..148
MhpC 149..408 CDD:223669 60/290 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..439 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.