powered by:
Protein Alignment CG5707 and si:dkey-122a22.2
DIOPT Version :9
Sequence 1: | NP_001246563.1 |
Gene: | CG5707 / 48422 |
FlyBaseID: | FBgn0026593 |
Length: | 361 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_697364.4 |
Gene: | si:dkey-122a22.2 / 568911 |
ZFINID: | ZDB-GENE-110411-93 |
Length: | 384 |
Species: | Danio rerio |
Alignment Length: | 31 |
Identity: | 10/31 - (32%) |
Similarity: | 15/31 - (48%) |
Gaps: | 6/31 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 YRKPPSQIDYLRKNIEGYIVEDERFANSKRQ 181
|:.|.|.|.:|.|.:. :|..|.:||
Zfish 360 YKNPSSLIKHLHKLVA------QRQTNQQRQ 384
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5707 | NP_001246563.1 |
MhpC |
46..318 |
CDD:223669 |
10/31 (32%) |
si:dkey-122a22.2 | XP_697364.4 |
MhpC |
77..377 |
CDD:223669 |
6/22 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170575061 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.