DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and si:dkey-122a22.2

DIOPT Version :10

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_697364.4 Gene:si:dkey-122a22.2 / 568911 ZFINID:ZDB-GENE-110411-93 Length:384 Species:Danio rerio


Alignment Length:31 Identity:10/31 - (32%)
Similarity:15/31 - (48%) Gaps:6/31 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YRKPPSQIDYLRKNIEGYIVEDERFANSKRQ 181
            |:.|.|.|.:|.|.:.      :|..|.:||
Zfish   360 YKNPSSLIKHLHKLVA------QRQTNQQRQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MenH 46..>165 CDD:440361 6/13 (46%)
Abhydrolase_6 48..310 CDD:463673 10/31 (32%)
si:dkey-122a22.2XP_697364.4 MenH 75..>250 CDD:440361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.