DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and CG5377

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_651052.1 Gene:CG5377 / 42645 FlyBaseID:FBgn0038974 Length:278 Species:Drosophila melanogaster


Alignment Length:288 Identity:66/288 - (22%)
Similarity:108/288 - (37%) Gaps:76/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RPILALHG-----WLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPE---GIAYHFVDYLCV 102
            |.:|.:.|     |.|.....::|..|||.|. ::..|.||:| .|..|:   |:.:...|....
  Fly    43 RSLLLMPGALGSSWTDFRPQIEQLPKLLPGHT-IIAWDPPGYG-KSVPPQRKFGLEFFREDAQAA 105

  Fly   103 I--LRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDML--------VSIDIVKTRYRKPPSQ 157
            :  :|.::..|:   |::..|...:...:.|..:....|.|        ::.|.||.        
  Fly   106 VDLMRALDRPRF---SILGWSDGGITALIVAGRHAEAVDRLAIWGAGAYLNADEVKA-------- 159

  Fly   158 IDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKF 222
                .|||     .|....:.:.:||       ||:|      |.||                :|
  Fly   160 ----LKNI-----RDVAKWSPRMREP-------MEKV------YGVE----------------RF 186

  Fly   223 PAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEVIGILRENNPH 287
            |..:....|..|.:|.:  ....|.......|| :|..::.|.:...|   :.|.|..|||..||
  Fly   187 PQLWAEWVDAACAFYDQ--RDGDFCRTEVEKIK-IPTFILHGKKDPMI---AAEHIPWLRERLPH 245

  Fly   288 FELHEV-QGTHHVHLNNAQGVAAVINPF 314
            .|.:|. :|.|::||..|:....::..|
  Fly   246 AEYYEFPEGKHNIHLRYAEEFNKLVADF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 66/288 (23%)
CG5377NP_651052.1 MhpC 26..274 CDD:223669 66/288 (23%)
Abhydrolase_5 45..257 CDD:289465 60/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.