DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and CG14717

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster


Alignment Length:275 Identity:47/275 - (17%)
Similarity:96/275 - (34%) Gaps:23/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QVRPILALHGWLDNLGTWDKLLPLLPKHLG---VLCIDLPGHGYSSKLPEGIAYHFVDYLCVILR 105
            |..||:.:|....:|.:|.::...| ..:|   |:.:|...||.|..:......|..   ..:..
  Fly    44 QAPPIVVMHDLNLSLESWRQVAVNL-SQVGLRQVITVDARNHGLSPYITGHSPMHLA---ADVEA 104

  Fly   106 VMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYLRKNIEGYI- 169
            :|...|..|:..:.|.|........|...|...:.::.:||...   ..||.....|:..|..: 
  Fly   105 LMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPA---PVPSNFYLTRQVFEMMLQ 166

  Fly   170 VEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRDGRC 234
            |.....:|....|...:.....:.|::..::....:.|.|.:.:.....:....|......:...
  Fly   167 VAPSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMI 231

  Fly   235 KYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEVIGILRENNPHFELHEVQGTHHV 299
            .|........|:..|:         .:|.||:|.::...|   |.:::...|:..:..:...|.|
  Fly   232 NYEATLGGLRPYMGEV---------LLIAGSQSEFVTTTS---IAVMQRYFPNTVVQILDAGHCV 284

  Fly   300 HLNNAQGVAAVINPF 314
            :.:..:....::..|
  Fly   285 YEDQPEQFVELVVEF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 46/273 (17%)
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 46/273 (17%)
Abhydrolase_5 47..>165 CDD:289465 26/124 (21%)
Abhydrolase <249..301 CDD:304388 10/54 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.