DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and abhd14a

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_996949.2 Gene:abhd14a / 404598 ZFINID:ZDB-GENE-040426-2428 Length:270 Species:Danio rerio


Alignment Length:160 Identity:40/160 - (25%)
Similarity:59/160 - (36%) Gaps:36/160 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQVRP---ILALHGWLDNLGTWDKL--LPLLPKH-LGVLCIDLPGHGYSSKLPEGIAYHF----V 97
            ||:.|   ::.|||......||::|  |.||... ...|.:||||:|.|   |:..:...    |
Zfish    88 RQILPRLQMVLLHGQAFTSKTWEELGTLSLLASSGYQALALDLPGYGNS---PDSESVKSDQSRV 149

  Fly    98 DYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYLR 162
            |   ::.|.:|....:...|::.|||......|...:..:....|.|..|.||...|....|.  
Zfish   150 D---LLKRFLEALGVRAPVLLSPSMSGHYALPFLQRHSAQLHGFVPIAPVGTRGITPQQYHDI-- 209

  Fly   163 KNIEGYIVEDERFANSKRQEPPAYTYTEME 192
                              |.|....|.|::
Zfish   210 ------------------QTPTLIIYGELD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 38/157 (24%)
abhd14aNP_996949.2 MhpC 96..269 CDD:223669 37/152 (24%)
Abhydrolase_5 97..249 CDD:289465 37/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.