DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and CG7632

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster


Alignment Length:306 Identity:137/306 - (44%)
Similarity:196/306 - (64%) Gaps:12/306 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NKEPMDVRIDMPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGY 84
            ||...::.|.:|||::.|||||.:.||||:.:|||.||.||:|.|.||||.||..|.||.||||.
  Fly    31 NKHFDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGL 95

  Fly    85 SSKLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKT 149
            ||.||.|.:||.:|.:.:..|:||||.|.|:|::|||||::..|||::|:|.:.|:.|.:|::|.
  Fly    96 SSWLPPGTSYHSIDLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKP 160

  Fly   150 RYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILER 214
            ..|.....:|.|.:.||..:..:.|..:.  .|||||.:.::...|::|::.||.::.|:::|:|
  Fly   161 PVRSARGIVDSLTERIESALKLERRLKSG--SEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQR 223

  Fly   215 NISRSTKFPAKFFFSRDGRCK---YYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYID--EQS 274
            |...||..|.|::||||.|.|   :|| .|...|.  |:||.|| .|:..||..::.|.:  |..
  Fly   224 NCKPSTHEPHKYYFSRDNRLKSSLFYT-LHQEVPM--EMARRIK-CPHLFIKALQAPYYERKEYF 284

  Fly   275 DEVIGILRENNPHFELHEVQGTHHVHLNNAQGVAAVINPFILHHRP 320
            |||:..| :.||.||.|||:||||||||..:.||.:||.||..:||
  Fly   285 DEVLAEL-QKNPLFEYHEVEGTHHVHLNEPEKVAPIINSFINRYRP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 123/276 (45%)
CG7632NP_649302.1 MhpC 57..326 CDD:223669 123/275 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448342
Domainoid 1 1.000 47 1.000 Domainoid score I11659
eggNOG 1 0.900 - - E2759_KOG1454
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109693at6656
OrthoFinder 1 1.000 - - FOG0001238
OrthoInspector 1 1.000 - - otm42436
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X774
109.900

Return to query results.
Submit another query.