DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and CG11309

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_649301.1 Gene:CG11309 / 40356 FlyBaseID:FBgn0037070 Length:358 Species:Drosophila melanogaster


Alignment Length:310 Identity:138/310 - (44%)
Similarity:205/310 - (66%) Gaps:6/310 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RLSIGAQNKEPMDVRIDMPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCI 77
            |.:|....|...::.|.:|||::.|||||.:.|:|||.||||.||.||:|:|:|||...:..|.|
  Fly    35 RANIWCSKKYFAEISITVPWGHISGKWYGPQNVQPILGLHGWQDNAGTFDRLMPLLSPDVAFLAI 99

  Fly    78 DLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLV 142
            ||||||.||:||:|..|:.||.|.||..:|::|:|:||||:.||||:::|||||:::|.:.||::
  Fly   100 DLPGHGLSSRLPDGCYYNSVDNLYVIRLIMKQYKWEKVSLVGHSMSSIICFVFAAVFPDKVDMII 164

  Fly   143 SIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELEN 207
            .||.:|...|..||.|..:...::.::.||||  |..:.|||:|||.|:.:.:|.||.:||..|:
  Fly   165 GIDALKPHQRPYPSVIRTMETRLDEFLREDER--NRSKNEPPSYTYDELIERVYIGTFHSVNKEH 227

  Fly   208 CRHILERNISRSTKFPAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDE 272
            |:|::.|||.:|.|:|.|:||.||.|.|:|.....|.....|:|..| ..||..||.::|:|.::
  Fly   228 CKHLMARNIGKSEKYPDKYFFCRDRRLKFYNYAIGSQELCVEMANRI-TCPYLFIKAAQSSYFED 291

  Fly   273 QS--DEVIGILRENNPHFELHEVQGTHHVHLNNAQGVAAVINPFILHHRP 320
            :.  |||:.:|.: .|:||..||.|:||||:|:.:.:.|.:|.||....|
  Fly   292 KKYYDEVLDVLLK-KPNFEYLEVNGSHHVHMNDPEAIIAPVNNFIQRFGP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 124/273 (45%)
CG11309NP_649301.1 MhpC 68..337 CDD:223669 124/272 (46%)
Abhydrolase_5 73..>158 CDD:289465 48/84 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448343
Domainoid 1 1.000 47 1.000 Domainoid score I11659
eggNOG 1 0.900 - - E2759_KOG1454
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109693at6656
OrthoFinder 1 1.000 - - FOG0001238
OrthoInspector 1 1.000 - - otm42436
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X774
109.900

Return to query results.
Submit another query.