DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Ephx4

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001001804.2 Gene:Ephx4 / 384214 MGIID:2686228 Length:359 Species:Mus musculus


Alignment Length:298 Identity:60/298 - (20%)
Similarity:111/298 - (37%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFVDYLCVILR 105
            |.|....:|.|||:.:...:|...|........|:.:||.|:|.|.......:|.....:..|..
Mouse    87 GERGKPLMLLLHGFPEFWYSWRHQLREFKSEYRVVALDLRGYGESDAPAHQESYKLDCLIADIKD 151

  Fly   106 VMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDI----VKTRY-RKPPSQIDYLRKNI 165
            :::...:.|..|:.|....|:.::.|..||.....|:.|:.    |.|.| .:.|:|:  .|.:.
Mouse   152 ILDSLGYSKCVLIGHDWGGMIAWLIAVCYPEMIMKLIVINFPHPSVFTEYILRHPAQL--FRSSF 214

  Fly   166 EGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAK----- 225
            . |..:..||                .:.::...|:..    .:|:.   .|:||....|     
Mouse   215 Y-YFFQIPRF----------------PEFMFSINDFKA----LKHLF---TSQSTGIGRKGRQLT 255

  Fly   226 --------FFFSR----DGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEVI 278
                    :.||:    .|...:|....:..|....:..|    |..::.|.|..:::.:..||.
Mouse   256 TEDLEAYVYVFSQPGALSGPINHYRNIFSCLPLKHHMVTT----PTLLLWGEEDAFMEVEMAEVT 316

  Fly   279 GILRENNPHFELHEV-QGTHHVHLNNAQGVAAVINPFI 315
            .|..:|  :|.|..: :|:|.:..:....|..:|..|:
Mouse   317 KIYVKN--YFRLTILSEGSHWLQQDQPDIVNGLIWAFL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 58/293 (20%)
Ephx4NP_001001804.2 MhpC 74..353 CDD:223669 60/298 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.