DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and CG15820

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_647696.1 Gene:CG15820 / 38277 FlyBaseID:FBgn0035312 Length:308 Species:Drosophila melanogaster


Alignment Length:313 Identity:148/313 - (47%)
Similarity:214/313 - (68%) Gaps:11/313 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IHNRLSIGAQNKEPMDVRIDMPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGV 74
            :|.||    |.:|   |.|..|||::.|:|||||..|||||:|||||||||:|:|:||||.::||
  Fly     1 MHKRL----QYEE---VMIPAPWGHIAGRWYGNRADRPILAIHGWLDNLGTFDRLIPLLPDYIGV 58

  Fly    75 LCIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTD 139
            |||||||||.||:||.|:.|:..||:.:|.|||:|:.|.|||||.||:..::.|::|::.|...|
  Fly    59 LCIDLPGHGRSSRLPPGVPYNVYDYVFIIPRVMKEFGWSKVSLMGHSLGGVMSFMYAAMAPSTVD 123

  Fly   140 MLVSIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVE 204
            |::|:|::..|..:.||:   |.|:||||::|:.|.|:....|||::|.:::.:.|.:.::.||.
  Fly   124 MIISLDVLLPRRIEDPSK---LTKDIEGYLLEERRQADGTEHEPPSFTLSKLRETLARNSNNSVP 185

  Fly   205 LENCRHILERNISRSTKFPAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNY 269
            .....|:|.|.:::|..:|.|.|||||||.|:|..|......|.|:||.|:..||.|||||.|.:
  Fly   186 QHLADHMLHRQVAKSNMYPEKVFFSRDGRVKFYHIFDIENGLALEMARRIEKKPYLVIKGSLSPF 250

  Fly   270 IDEQSDEVIGILRENNPHFELHEVQ-GTHHVHLNNAQGVAAVINPFILHHRPP 321
            :..:.:|.:.||..:||:||.:||: |.|||||:.|:..|..|.|||.:||||
  Fly   251 VGPRCNETMSILSHDNPNFEFYEVEGGKHHVHLHAAEECARYIVPFIRNHRPP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 128/272 (47%)
CG15820NP_647696.1 MhpC 24..300 CDD:223669 132/278 (47%)
Abhydrolase_5 31..>119 CDD:289465 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448337
Domainoid 1 1.000 99 1.000 Domainoid score I7022
eggNOG 1 0.900 - - E2759_KOG1454
Homologene 1 1.000 - - H120031
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109693at6656
OrthoFinder 1 1.000 - - FOG0001238
OrthoInspector 1 1.000 - - otm42436
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X774
1110.900

Return to query results.
Submit another query.