DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Jheh2

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_611386.2 Gene:Jheh2 / 37181 FlyBaseID:FBgn0034405 Length:463 Species:Drosophila melanogaster


Alignment Length:335 Identity:67/335 - (20%)
Similarity:123/335 - (36%) Gaps:84/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSIGAQNKEPMDVRIDMPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLL--PKH----- 71
            |.|...:.:|..|:...|           ::|.|:|.:|||...:..:...:|||  |..     
  Fly   134 LKIHFIHAKPSQVKGQKP-----------KKVLPLLLMHGWPGTVREFYDFIPLLTTPSDKSDYV 187

  Fly    72 LGVLCIDLPGHGY---SSKLPEGIAYHFVDYLCVILR-VMEEYRWQKVSLMAHSMSAMLCFVFAS 132
            ..|:...|||:|:   |||...|:|     .:.|::| :|....:.|..:......:::....||
  Fly   188 FEVIAPSLPGYGWSQGSSKTGFGVA-----QVAVVMRNLMLRVGFDKFLVQGGDWGSIIGSNVAS 247

  Fly   133 LYP-----HRTDMLVSIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFAN---------SKRQEP 183
            |:|     :.::|..:        ..|..|:..:..:.......|..:|:         |...|.
  Fly   248 LFPENVLGYHSNMCGN--------NSPMGQLKMVLASFFPSWFVDSEYADFYKGLGHLFSTIMEE 304

  Fly   184 PAYTYTEMEQVLYKGTDYSVELEN----CRHILER-NISRSTKFPA--------KFFFSR--DGR 233
            ..|.:.:..:   ..|..:..::|    ..:|||: :...:|.|.:        :|.:.:  |..
  Fly   305 MGYAHIQASK---PDTIGNALIDNPTGLASYILEKFSTWTNTAFRSLPDGGLTKRFTYDQLLDNV 366

  Fly   234 CKYYT--------EFHTSPPFAAELARTIKNVPYCVIKGSE--SNYIDEQSDEVIGILRENNPHF 288
            ..||.        ..::....|::.|..:.:||.....|..  ::.|...||.|   |....|:.
  Fly   367 MIYYVTNSITTSMRLYSESMVASQFALAVDSVPIKAKAGCTRFAHEITHFSDSV---LANKFPNL 428

  Fly   289 ELHEVQGTHH 298
                |..|||
  Fly   429 ----VHSTHH 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 61/303 (20%)
Jheh2NP_611386.2 EHN 58..165 CDD:283978 11/41 (27%)
Abhydrolase 111..>251 CDD:304388 32/132 (24%)
Abhydrolase_1 156..370 CDD:278959 44/229 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.