DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Bphl

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001032283.1 Gene:Bphl / 361239 RGDID:1307572 Length:291 Species:Rattus norvegicus


Alignment Length:303 Identity:59/303 - (19%)
Similarity:101/303 - (33%) Gaps:110/303 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILALHGWLDNLGTWD---KLLPLLPKHLGVLCIDLPGHGYSSKLP---------EGIAYHFVDYL 100
            :|.|.|.|.: |..|   :|..|..|...::..|..|:| .|:.|         |..|...||  
  Rat    63 VLLLPGMLGS-GKTDFAPQLQSLNKKRFTLVAWDPRGYG-ESRPPDRDFPRDFFERDAKDAVD-- 123

  Fly   101 CVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYLRKNI 165
                 :|:..::::|||:..|...:...:.|:.||                       .|:||.:
  Rat   124 -----LMKALQFKQVSLLGWSDGGITALIAAAKYP-----------------------SYIRKMV 160

  Fly   166 ----EGYIV-EDERFAN--------SKRQEPPAYTYTEMEQVLYKGTDYSVE--------LENCR 209
                ..|:. ||.|...        |::...|.       :.|| |.||..:        :...:
  Rat   161 IWGANAYVTEEDSRIYQGIRDVSKWSEKARKPL-------EALY-GHDYFAKTCEKWVDGINQFK 217

  Fly   210 HILERNISRSTKFPAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDE-Q 273
            |:.:.||.|                      |..|         :...|..::.|.:...:.. .
  Rat   218 HLPDGNICR----------------------HLLP---------LIQCPTLIVHGEKDPLVPRFH 251

  Fly   274 SDEVIGILRENNPHFELHEV-QGTHHVHLNNAQGVAAVINPFI 315
            :|    .|.|:.....||.: :|.|::||..|.....::..|:
  Rat   252 AD----FLLEHVKGSRLHLMPEGKHNLHLRFADEFNRLVEDFL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 59/303 (19%)
BphlNP_001032283.1 MhpC 44..291 CDD:223669 59/303 (19%)
Abhydrolase 58..259 CDD:304388 51/270 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.