DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Abhd11

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001258109.1 Gene:Abhd11 / 360831 RGDID:1304681 Length:307 Species:Rattus norvegicus


Alignment Length:322 Identity:63/322 - (19%)
Similarity:105/322 - (32%) Gaps:88/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WIHNRLSIGAQNKEPMDVRIDMPWGYVVGKWYGNRQVRP----------------ILALHGWLDN 57
            |...|.:|||.:  |....:.:.:........||...||                |:.|||...:
  Rat     8 WRVPRGTIGASS--PRSSAVPVTFSSSRSSGQGNADPRPLPLSYNLLDGDATLPAIVLLHGLFGS 70

  Fly    58 LGTWDKLLPLLPKHLG--VLCIDLPGHGYSSKLPEGIAYH--------FVDYLCVILRVMEEYRW 112
            ...::.|...|.:..|  ||.:|...||.|...|:. :|.        .:..|.::..|      
  Rat    71 KSNFNSLAKALVQRTGRRVLTVDARNHGDSPHSPDA-SYEAMSQDLQGLLPQLGLVPSV------ 128

  Fly   113 QKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKP---------------------PS 156
                |:.|||......:.|...|...:.||.:||      .|                     |.
  Rat   129 ----LVGHSMGGKTAMLLALQRPDVVERLVVVDI------SPAGTTPGSYLGNFIAAMKAVDIPE 183

  Fly   157 QIDYLRKNIEGYIVEDERFAN-----SKRQEPPAYTYTEMEQVLYKGT-DYSVELENCRHILERN 215
            .|.:.|..    .:.||:.::     |.||    :..|.:.:|  .|. .:.|.|:.....|::.
  Rat   184 NIPHSRAR----KLADEQLSSVVKEASVRQ----FLLTNLVEV--NGRFSWRVNLDALAQQLDKI 238

  Fly   216 IS---RSTKFPAKFFFSRDGRCKYYTEFHTSP---PFAAELARTIKNVPYCVIKGSESNYID 271
            ::   :...:|....|...|...|....|.|.   .|.....:|:.|..:.|......:::|
  Rat   239 LTFPQQLESYPGSTLFLLGGNSPYVPPSHHSAIRRLFPQTQIQTVPNAGHWVHSDKPQDFMD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 55/285 (19%)
Abhd11NP_001258109.1 Abhydrolase_5 60..195 CDD:289465 31/155 (20%)
PRK10673 61..307 CDD:182637 53/267 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.