DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and puml

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster


Alignment Length:447 Identity:78/447 - (17%)
Similarity:136/447 - (30%) Gaps:170/447 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSIGAQNKEPMDVRIDMPWGYVVGKWYGN---------RQVR----------------------- 46
            :::|:::|..||:.......:.:.||..|         |.|.                       
  Fly    32 VALGSESKSSMDLEDPRNNRFFLWKWLCNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVG 96

  Fly    47 -----------------PILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAY 94
                             |::.|||....:..|...|....|...|..:|:.|.|.||:     ..
  Fly    97 EADKIWTISMNTESKEVPLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSR-----PL 156

  Fly    95 HFVDYLCV---ILRVMEEYRWQ----KVSLMAHSMSAMLCFVFASLYPHRTDMLVSID------- 145
            ...|.|..   .::.:||:|.:    .:.|:.|||...:...:|..:|.|...|:..|       
  Fly   157 FAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEK 221

  Fly   146 ----------------------------------------IVKTRYRKPPSQIDYLRKNIEGYIV 170
                                                    :.|||    |   |.:|| .:..|.
  Fly   222 PSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTR----P---DIMRK-FQSTIE 278

  Fly   171 EDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRDGRCK 235
            ||...               :.|.:::....:...|:..|.:.::.               |..|
  Fly   279 EDINL---------------LPQYIHQCNAQNPSGESAFHTMMQSF---------------GWAK 313

  Fly   236 YYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEVIGILRENNPHFELHEVQGT-HHV 299
            :        |....:.....::|...|.||.| :||..|.|.|...|.:| ..::..|.|. |||
  Fly   314 H--------PMIHRIKDVRSDIPITFIYGSRS-WIDSSSGEKIKSQRGSN-MVDIKIVTGAGHHV 368

  Fly   300 HLNNAQGVAAVINPFILHHRPPHLENWTVDGTDETLPEVVKEFKLAVEDSENVKRRK 356
            :.:...    |.|.::         |.|.|.......:::...:|..|.:|:.:.|:
  Fly   369 YADKPD----VFNRYV---------NETCDMYKVAGGKLITPLQLIRESTESDEERE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 62/366 (17%)
pumlNP_001286169.1 MhpC 114..382 CDD:223669 62/333 (19%)
Abhydrolase_5 114..>226 CDD:289465 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.