DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Abhd14a

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001009670.1 Gene:Abhd14a / 300982 RGDID:1309721 Length:242 Species:Rattus norvegicus


Alignment Length:197 Identity:42/197 - (21%)
Similarity:71/197 - (36%) Gaps:62/197 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQVRP--------ILALHGWLDNLGTWDKL--LPLLPKH-LGVLCIDLPGHGYSS---------- 86
            |:|.|        ::.|||...|..||::|  |.||.|. ...:.:||||.|.|:          
  Rat    55 REVLPLQQTHRAEVVFLHGKAFNSHTWEQLGTLQLLSKRGYRAVAVDLPGFGNSAPSKEVSTESG 119

  Fly    87 --KLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKT 149
              :|.||              |:.:.:.|...|::.|:|......|.....|:....|.|     
  Rat   120 RVELLEG--------------VLRDLQLQNTVLVSPSLSGSYALPFLMQSHHQLCGFVPI----- 165

  Fly   150 RYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILER 214
               .|.|..:|.::..:..            :.|....|.|::..|.:.:     |:..||:...
  Rat   166 ---APTSTRNYAQEQFQAV------------KTPTLILYGELDHTLARES-----LQQLRHLPNH 210

  Fly   215 NI 216
            ::
  Rat   211 SV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 40/194 (21%)
Abhd14aNP_001009670.1 MhpC 45..241 CDD:223669 42/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.