Sequence 1: | NP_001246563.1 | Gene: | CG5707 / 48422 | FlyBaseID: | FBgn0026593 | Length: | 361 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009670.1 | Gene: | Abhd14a / 300982 | RGDID: | 1309721 | Length: | 242 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 42/197 - (21%) |
---|---|---|---|
Similarity: | 71/197 - (36%) | Gaps: | 62/197 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 RQVRP--------ILALHGWLDNLGTWDKL--LPLLPKH-LGVLCIDLPGHGYSS---------- 86
Fly 87 --KLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKT 149
Fly 150 RYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILER 214
Fly 215 NI 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5707 | NP_001246563.1 | MhpC | 46..318 | CDD:223669 | 40/194 (21%) |
Abhd14a | NP_001009670.1 | MhpC | 45..241 | CDD:223669 | 42/197 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166335856 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |