DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Ephx4

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001099464.1 Gene:Ephx4 / 289440 RGDID:1308891 Length:266 Species:Rattus norvegicus


Alignment Length:291 Identity:56/291 - (19%)
Similarity:109/291 - (37%) Gaps:55/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRW 112
            :|.|||:.:...:|...|........|:.:||.|:|.|.......:|.....:..|..|::...:
  Rat     1 MLLLHGFPEFWYSWRHQLREFKSEYRVVALDLRGYGESDAPIHQESYKLDCLIADIKDVLDSLGY 65

  Fly   113 QKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDI----VKTRY-RKPPSQIDYLRKNIEGYIVED 172
            .|..|:.|....|:.::.|..||.....|:.|:.    |.|.| .:.|:|:  .|.:...:    
  Rat    66 NKCVLIGHDWGGMIAWLIAVCYPEMIMKLIVINFPHPSVFTEYILRHPAQL--FRSSFYYF---- 124

  Fly   173 ERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAK------------ 225
                         :....:.::::...|:..    .:|:.   .|:||....|            
  Rat   125 -------------FQIPRLPELMFSINDFKA----LKHLF---TSQSTGIGRKGRQLTTEDLEAY 169

  Fly   226 -FFFSR----DGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEVIGILRENN 285
             :.||:    .|...:|....:..|....:..|    |..::.|.|..:::.:..||..|..:| 
  Rat   170 VYVFSQPGALSGPINHYRNIFSCLPLKHHMVTT----PTLLLWGEEDAFMEVEMAEVTKIYVKN- 229

  Fly   286 PHFELHEV-QGTHHVHLNNAQGVAAVINPFI 315
             :|.|..: :|:|.:..:....|..:|..|:
  Rat   230 -YFRLTILSEGSHWLQQDQPDIVNGLIWAFL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 56/291 (19%)
Ephx4NP_001099464.1 MhpC 1..260 CDD:223669 56/291 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.