Sequence 1: | NP_001246563.1 | Gene: | CG5707 / 48422 | FlyBaseID: | FBgn0026593 | Length: | 361 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056222.2 | Gene: | ABHD14A / 25864 | HGNCID: | 24538 | Length: | 271 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 48/206 - (23%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 48/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 WG-----YVVGKWYGN-----RQVRP--------ILALHGWLDNLGTWDKL--LPLLPKH-LGVL 75
Fly 76 CIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDM 140
Fly 141 LVSIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVEL 205
Fly 206 ENCRHILERNI 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5707 | NP_001246563.1 | MhpC | 46..318 | CDD:223669 | 41/182 (23%) |
ABHD14A | NP_056222.2 | MhpC | 74..270 | CDD:223669 | 45/195 (23%) |
Abhydrolase_5 | 97..250 | CDD:289465 | 40/172 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165142130 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |