DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and ABHD14A

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_056222.2 Gene:ABHD14A / 25864 HGNCID:24538 Length:271 Species:Homo sapiens


Alignment Length:206 Identity:48/206 - (23%)
Similarity:77/206 - (37%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WG-----YVVGKWYGN-----RQVRP--------ILALHGWLDNLGTWDKL--LPLLPKH-LGVL 75
            ||     .:.|...||     |:|.|        ::.|||...|..||::|  |.||.:. ...:
Human    63 WGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLSQRGYRAV 127

  Fly    76 CIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDM 140
            .:||||.|.|:  |...|........::.|.:.:...|...|::.|:|......|.....|:...
Human   128 ALDLPGFGNSA--PSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHG 190

  Fly   141 LVSIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVEL 205
            .|.|        .|.|..:|.:          |:|...|  .|....|.|::.:|.:.:     |
Human   191 FVPI--------APTSTQNYTQ----------EQFWAVK--TPTLILYGELDHILARES-----L 230

  Fly   206 ENCRHILERNI 216
            ...||:...::
Human   231 RQLRHLPNHSV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 41/182 (23%)
ABHD14ANP_056222.2 MhpC 74..270 CDD:223669 45/195 (23%)
Abhydrolase_5 97..250 CDD:289465 40/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.