Sequence 1: | NP_001246563.1 | Gene: | CG5707 / 48422 | FlyBaseID: | FBgn0026593 | Length: | 361 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001970.2 | Gene: | EPHX2 / 2053 | HGNCID: | 3402 | Length: | 555 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 46/205 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 DMPWGYVVGKWYGNRQVR---------PILAL-HGWLDNLGTWDKLLPLLPK-HLGVLCIDLPGH 82
Fly 83 GYSSKLPEGIAYHFVDYLC-VILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDI 146
Fly 147 VKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHI 211
Fly 212 LERNISRSTK 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5707 | NP_001246563.1 | MhpC | 46..318 | CDD:223669 | 42/188 (22%) |
EPHX2 | NP_001970.2 | Phosphatase | 1..224 | ||
HAD_sEH-N_like | 3..214 | CDD:319790 | |||
Phosphate binding. /evidence=ECO:0000269|PubMed:15096040 | 123..124 | ||||
Epoxide hydrolase | 235..555 | 49/205 (24%) | |||
Abhydrolase_1 | 259..531 | CDD:395444 | 41/178 (23%) | ||
Microbody targeting signal. /evidence=ECO:0000255 | 553..555 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165142142 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |