DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and EPHX2

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001970.2 Gene:EPHX2 / 2053 HGNCID:3402 Length:555 Species:Homo sapiens


Alignment Length:205 Identity:49/205 - (23%)
Similarity:82/205 - (40%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DMPWGYVVGKWYGNRQVR---------PILAL-HGWLDNLGTWDKLLPLLPK-HLGVLCIDLPGH 82
            ||..|||..|    .:||         |.:.| ||:.::..:|...:|.|.: ...||.:|:.|:
Human   236 DMSHGYVTVK----PRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGY 296

  Fly    83 GYSSKLPEGIAYHFVDYLC-VILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDI 146
            |.||..|| |..:.::.|| .::..:::....:...:.|....||.:..|..||.|...:.|::.
Human   297 GESSAPPE-IEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT 360

  Fly   147 VKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHI 211
            .........|.::.::.|                   |.:.|.     ||.......|.|     
Human   361 PFIPANPNMSPLESIKAN-------------------PVFDYQ-----LYFQEPGVAEAE----- 396

  Fly   212 LERNISRSTK 221
            ||:|:||:.|
Human   397 LEQNLSRTFK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 42/188 (22%)
EPHX2NP_001970.2 Phosphatase 1..224
HAD_sEH-N_like 3..214 CDD:319790
Phosphate binding. /evidence=ECO:0000269|PubMed:15096040 123..124
Epoxide hydrolase 235..555 49/205 (24%)
Abhydrolase_1 259..531 CDD:395444 41/178 (23%)
Microbody targeting signal. /evidence=ECO:0000255 553..555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.