DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Y73C8B.1

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_503880.1 Gene:Y73C8B.1 / 190658 WormBaseID:WBGene00022258 Length:311 Species:Caenorhabditis elegans


Alignment Length:210 Identity:40/210 - (19%)
Similarity:71/210 - (33%) Gaps:71/210 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KHLGV--LCIDLPGHGYSSKLPEGIAYHFVD-----YLCVILRVMEEYRWQKVSLMAHSMSAMLC 127
            :|:.:  :.|:.||...:...|   ..||.:     |...:|..::..  .||.:|.||......
 Worm    73 EHMNIRFIGINYPGFKQTPAYP---GQHFGNWERNSYSEALLNELDVQ--GKVIIMGHSRGCESA 132

  Fly   128 FVFA-SLYPHRTDMLVSIDIVKTRYRK---PPSQID---YLRKNIE---------------GYIV 170
            .:.| :..||.   ||.::....|..|   |..:::   |..|.:.               |:.:
 Worm   133 LITATNRKPHG---LVMVNPTGLRIHKGSRPKGKLESLVYFHKKLPKTVGDTIMYNLMKSVGFKI 194

  Fly   171 EDERFANS------------------KRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILER--- 214
            :|...|.:                  |..|.|..|     .:.:.|:|:.:|.|.....|::   
 Worm   195 QDGEEAVAVIRAIMNCDLEKQLEYILKLNEQPTKT-----MITFGGSDHLIEKEIVFEALKKYQG 254

  Fly   215 --------NISRSTK 221
                    ||:.|.|
 Worm   255 LAHFNFKANITESEK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 40/210 (19%)
Y73C8B.1NP_503880.1 DUF1057 15..310 CDD:115027 40/210 (19%)
MhpC 29..258 CDD:223669 36/197 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.