DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and K08D9.4

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001305193.1 Gene:K08D9.4 / 187147 WormBaseID:WBGene00019525 Length:311 Species:Caenorhabditis elegans


Alignment Length:192 Identity:37/192 - (19%)
Similarity:66/192 - (34%) Gaps:51/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGAQNKEPMDVRIDMPWGYVVGKWYGNR---QVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCI 77
            |.|.|::|..:.:..|.|..:.|  |:|   ::..::.||             ..|||.:|...:
 Worm   134 ITAANRKPHGLVMANPTGLRINK--GSRPKGKLESLIYLH-------------KKLPKKIGDAIL 183

  Fly    78 DLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQK---VSLMAHSMSAMLCFVFASLYPHRTD 139
                  |:.....|...|..:....::|.:.....:|   ..|..:.:.......|..     :|
 Worm   184 ------YNLMKLVGFKIHDGEEAVAVIRAIMNCDLEKQLEYILKLNELPTKTMITFGG-----SD 237

  Fly   140 MLVSIDIVKTRYRK----------------PPSQIDYLRKNIEG---YIVEDERFANSKRQE 182
            .|:..:||....:|                ...:|....||.:|   :|.:|..|.|.||.:
 Worm   238 HLIEKEIVFEALKKYQGLAHFNFKANITESEKQKIMESFKNQKGTSVFIAKDNHFQNKKRAD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 28/159 (18%)
K08D9.4NP_001305193.1 DUF1057 15..310 CDD:115027 37/192 (19%)
MhpC 46..258 CDD:223669 27/149 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.