DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and ceeh-2

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001256211.1 Gene:ceeh-2 / 179444 WormBaseID:WBGene00010628 Length:355 Species:Caenorhabditis elegans


Alignment Length:295 Identity:57/295 - (19%)
Similarity:119/295 - (40%) Gaps:51/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIA----YHFVDYLCVILRVME 108
            :|.:||:.:...:|...|.........:.||:.|:..:.: |.||:    .|.|:.:...:.::|
 Worm    79 LLMVHGFPEFWYSWRFQLEHFKHTHRCIAIDMRGYNTTDR-PSGISDYNLTHLVEDIRQFIEILE 142

  Fly   109 EYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIV----------KTRYRKPPSQIDYLRK 163
               .::|:|.||...|::|:..|.|:.:..|.||..::.          .::.::..|...||.:
 Worm   143 ---LKRVTLAAHDWGAIVCWRVAMLHSNLIDRLVICNVPHPFAFFEVYNMSKEQRNKSWYIYLFQ 204

  Fly   164 NIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFF 228
            :  .||.|....:|..:          |.:.:::|:...:.       ...|.:.......|..|
 Worm   205 S--QYIPEIAMRSNKMK----------MLEAMFRGSKAGIR-------NSENFTDEDMLAWKHVF 250

  Fly   229 SR----DGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEV-IGILRENNPHF 288
            |:    .|...||.:...:|....:|  .|......::.|.|..::|::..|: :...|:    .
 Worm   251 SQPGGTTGPLNYYRDLFNAPAIPRKL--QIVQPKVLILWGDEDAFLDKKGAELSVQFCRD----C 309

  Fly   289 ELHEVQG-THHVHLNNAQGVAAVINPFILH--HRP 320
            .:..::| :|.|..:..|.|...:..|:..  :||
 Worm   310 RVQMIRGASHWVQQDQPQLVNVYMEQFMNEDSYRP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 55/291 (19%)
ceeh-2NP_001256211.1 Abhydrolase 63..>210 CDD:304388 30/136 (22%)
Abhydrolase_1 77..322 CDD:278959 51/271 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.