DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and F10D2.10

DIOPT Version :10

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_504815.2 Gene:F10D2.10 / 179101 WormBaseID:WBGene00017335 Length:333 Species:Caenorhabditis elegans


Alignment Length:81 Identity:18/81 - (22%)
Similarity:36/81 - (44%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYP-HRTDMLVS 143
            ||.|:.:|..:       :|....|:..:  ...||..:|||.......:.|:.:| |...|:..
 Worm   108 PGQGHCNKERQ-------NYTDAFLKSAD--LSGKVIFLAHSRGCENALMTATTFPAHGLVMMNP 163

  Fly   144 IDIVKTRYRKPPSQID 159
            :.:.|.:..:|.|:::
 Worm   164 LGLRKHKSIRPLSRLE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MenH 46..>165 CDD:440361 18/81 (22%)
Abhydrolase_6 48..310 CDD:463673 18/81 (22%)
F10D2.10NP_504815.2 DUF1057 29..324 CDD:115027 18/81 (22%)

Return to query results.
Submit another query.