DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and F10D2.10

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_504815.2 Gene:F10D2.10 / 179101 WormBaseID:WBGene00017335 Length:333 Species:Caenorhabditis elegans


Alignment Length:81 Identity:18/81 - (22%)
Similarity:36/81 - (44%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PGHGYSSKLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYP-HRTDMLVS 143
            ||.|:.:|..:       :|....|:..:  ...||..:|||.......:.|:.:| |...|:..
 Worm   108 PGQGHCNKERQ-------NYTDAFLKSAD--LSGKVIFLAHSRGCENALMTATTFPAHGLVMMNP 163

  Fly   144 IDIVKTRYRKPPSQID 159
            :.:.|.:..:|.|:::
 Worm   164 LGLRKHKSIRPLSRLE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 18/81 (22%)
F10D2.10NP_504815.2 DUF1057 29..324 CDD:115027 18/81 (22%)
MhpC 59..272 CDD:223669 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.