DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and W01A11.1

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_504650.1 Gene:W01A11.1 / 179036 WormBaseID:WBGene00020909 Length:452 Species:Caenorhabditis elegans


Alignment Length:278 Identity:58/278 - (20%)
Similarity:98/278 - (35%) Gaps:85/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KWYGNRQVRPILALHGWLDNLGTWDKLLPLL--PKHLG--------VLCIDLPGHGYSSKLPEGI 92
            |.|.|  |:|||..|||..|:..:.|.:|||  ||..|        |:...:||:|:|.: |:..
 Worm   137 KSYKN--VKPILVAHGWPGNVFEFYKFIPLLTDPKKHGIDSDFAFEVIAPSIPGYGWSDQ-PKKT 198

  Fly    93 AYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRT------------------- 138
            .:..:....|..::|....:.|..|......|::..:...:||...                   
 Worm   199 GFSQLACARVFRKLMLRLGYNKFYLQGGDWGAIITSLLTKVYPQNVMALHLNMMPAMPGANALGT 263

  Fly   139 --DML----------------------VSIDIVKTRY-----RKPPSQIDYLRKN---IEGYIVE 171
              |:|                      ..:.||:|.|     .||.:....|..:   :..||:|
 Worm   264 FYDILGWLIPSTLSSKEIQKTHNPFSKFGLLIVETGYMHLQATKPDTAGTSLNDSPIGLAAYIIE 328

  Fly   172 D-ERFANSKRQEPP------AYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFS 229
            . ..:.|::.:..|      .:|..|:..::            ..:....||..|.:|..:.|..
 Worm   329 KFSTWTNTENRALPDGGLNKRFTNDELLTIV------------MIYWTNGNIVSSQRFYREMFLD 381

  Fly   230 RDGRCKYYTEFHTSPPFA 247
            |  ||:...:.:.|.|.|
 Worm   382 R--RCEALGKRYVSTPTA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 54/270 (20%)
W01A11.1NP_504650.1 EHN 51..153 CDD:283978 10/17 (59%)
MhpC 122..449 CDD:223669 58/278 (21%)
Abhydrolase 126..>232 CDD:304388 29/97 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.