DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Y73C8B.3

DIOPT Version :10

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_503878.2 Gene:Y73C8B.3 / 178756 WormBaseID:WBGene00022260 Length:328 Species:Caenorhabditis elegans


Alignment Length:125 Identity:25/125 - (20%)
Similarity:47/125 - (37%) Gaps:31/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 PAKFF--FSRDGRCKYYTEFHTSPPFAAELARTIKN-----VPYCVI------KGSESN--YIDE 272
            |:|.|  .:....|:...:|.|......||....::     .|:..:      .||.::  ||..
 Worm    14 PSKVFQKMTEPNLCRKLVKFETESGKKVELDAVYEDSLTSGSPFGTVVAFHGSPGSHNDFKYIRS 78

  Fly   273 QSDEV----IGILRENNPHFEL-HEVQGTHHVHLNNAQGVAAVIN--------PFILHHR 319
            :.|::    ||:   |.|.|.. :|.....|:::.......|:::        .:|.|.|
 Worm    79 KLDDLKIRFIGV---NYPGFTFTNEYPDQKHINIERQNYSNALLDELGIDGKMAYIGHSR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MenH 46..>165 CDD:440361
Abhydrolase_6 48..310 CDD:463673 21/106 (20%)
Y73C8B.3NP_503878.2 DUF1057 23..319 CDD:115027 22/116 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.