DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and Ephx2

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_031966.2 Gene:Ephx2 / 13850 MGIID:99500 Length:554 Species:Mus musculus


Alignment Length:273 Identity:64/273 - (23%)
Similarity:107/273 - (39%) Gaps:67/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IHNRLS--------IGAQNKE-PMDVRI---DMPWGYVVGK-----WYGNRQVRPILAL-HGWLD 56
            :||..|        .|.|..| |:.|..   |:..|||..|     .:......|.|.| ||:.:
Mouse   203 VHNTASALRELEKVTGTQFPEAPLPVPCNPNDVSHGYVTVKPGIRLHFVEMGSGPALCLCHGFPE 267

  Fly    57 NLGTWDKLLPLLPK-HLGVLCIDLPGHGYSSKLPEGIAYHFVDYLC-VILRVMEEYRWQKVSLMA 119
            :..:|...:|.|.: ...||.||:.|:|.||..|| |..:.::.|| .::..:::....:...:.
Mouse   268 SWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSPPE-IEEYAMELLCKEMVTFLDKLGIPQAVFIG 331

  Fly   120 HSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYLR--KNIEGYIVEDERFANSKRQE 182
            |..:.::.:..|..||.|...:.|::   |.:..|...:..::  ::|                 
Mouse   332 HDWAGVMVWNMALFYPERVRAVASLN---TPFMPPDPDVSPMKVIRSI----------------- 376

  Fly   183 PPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRD--GRCKYYTEFHTSPP 245
             |.:.|.     ||.......|.|     ||:|:||:.|   .||.:.|  |    :...|.   
Mouse   377 -PVFNYQ-----LYFQEPGVAEAE-----LEKNMSRTFK---SFFRASDETG----FIAVHK--- 420

  Fly   246 FAAELARTIKNVP 258
             |.|:...:.|.|
Mouse   421 -ATEIGGILVNTP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 51/220 (23%)
Ephx2NP_031966.2 Phosphatase 1..224 5/20 (25%)
HAD_sEH-N_like 3..214 CDD:319790 3/10 (30%)
Phosphate binding. /evidence=ECO:0000250|UniProtKB:P34913 123..124
Epoxide hydrolase 233..554 56/243 (23%)
Abhydrolase_1 257..530 CDD:395444 51/219 (23%)
Microbody targeting signal. /evidence=ECO:0000255 552..554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.