DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and abhd8b

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_005155763.1 Gene:abhd8b / 101883400 ZFINID:ZDB-GENE-130530-805 Length:482 Species:Danio rerio


Alignment Length:333 Identity:67/333 - (20%)
Similarity:117/333 - (35%) Gaps:84/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QWIHNRLSIGAQNKEPMDVRIDMPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPKHL 72
            |.:|.|     :.|....:.||........|  |......:..:||...:|..|...|... ..|
Zfish   139 QQVHRR-----RRKPKRSIVIDCERKITCCK--GTHPDVALFFIHGVGGSLDIWRSQLDFF-SQL 195

  Fly    73 G--VLCIDLPGHGYSS--KLPEGIAYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASL 133
            |  |:.:||.|||.||  ::|  .||.|......:..:.:.|..::..|:.||.....|...|..
Zfish   196 GYEVIAMDLAGHGASSAPRIP--AAYTFYALAEDVRIIFKRYAKRRNILVGHSYGVSFCTFLAHE 258

  Fly   134 YPHRTDMLVSID---------IVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYT 189
            ||.:...||.|:         .:.:.:..|...:::|                     .|..|::
Zfish   259 YPEQVHKLVMINGGGPTALEPSLCSVFNLPTCVLNFL---------------------SPCLTWS 302

  Fly   190 -EMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRDGRCKYYTE----FHTSPPFAAE 249
             .|....::||      ...:.:.|.|....:.|..:...|.    :|:.|    :|      ||
Zfish   303 FLMAGFAHQGT------REKKLLKENNAFNVSSFVLRSMMSG----QYWPEGDEVYH------AE 351

  Fly   250 LARTIKNVPYCVIKGSESNYIDEQSDE------VIGILRENNPHFELHEVQGTHHVHLNNAQGVA 308
            :     .||..::.|....::..|.|:      ::|.|:..:        .|:|.|.:.....|.
Zfish   352 I-----TVPVLLVHGMYDKFVPVQEDQRMAEILLLGFLKVLD--------DGSHMVMMECPDVVN 403

  Fly   309 AVINPFIL 316
            .:::.|.|
Zfish   404 TLLHEFFL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 59/295 (20%)
abhd8bXP_005155763.1 MhpC 167..410 CDD:223669 57/295 (19%)
Abhydrolase_5 171..392 CDD:289465 54/273 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.