DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and ephx4

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_002933851.2 Gene:ephx4 / 100492111 XenbaseID:XB-GENE-983897 Length:361 Species:Xenopus tropicalis


Alignment Length:298 Identity:65/298 - (21%)
Similarity:119/298 - (39%) Gaps:47/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFVDYLCVIL- 104
            |.|....:|.|||:.:...:|...|........|:.:||.|:| .:..|..|..:.:|  |:|: 
 Frog    87 GERGKPLMLLLHGFPEFWYSWRHQLREFKSEYRVVALDLRGYG-ETDAPTNIDSYKLD--CIIVD 148

  Fly   105 --RVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDI----VKTRY-RKPPSQIDYLR 162
              .:::...:.|..|:.|....|:.::.|..||.....|:.:..    |.|.| .:.|||   |.
 Frog   149 VKEIVDSLGYTKCVLIGHDWGGMIAWLTAICYPEMVTKLIVLSFPHPTVFTEYILRHPSQ---LI 210

  Fly   163 KNIEGYIVEDERFANSKRQEP--PAYTYT----EMEQVLYKGTDYSVELENCRHILERNISRSTK 221
            |:  ||..    |.    |.|  |...||    ::.:.|:..||..:....|| ..|.::.... 
 Frog   211 KS--GYYF----FF----QMPWFPELMYTVNDYKVLKDLFTSTDTGIGKHGCR-FTEEDMEAYL- 263

  Fly   222 FPAKFFFSR----DGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYIDEQSDEVIGILR 282
                :.||:    .|...:|....:..|    |......:|..::.|....:::.:..|:..:..
 Frog   264 ----YIFSQPGALSGPLNHYRNICSCLP----LKHHQVTMPTLLLWGENDAFVEVEMAELTRVYV 320

  Fly   283 ENNPHFELHEVQ-GTHHVHLNNAQGVAAVINPFILHHR 319
            :|  :|:|..:. .:|.:..:..:.|..:|..|:...|
 Frog   321 KN--YFQLSVLSYASHWIQQDQPELVNTLIWTFLEEDR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 62/290 (21%)
ephx4XP_002933851.2 Abhydrolase 64..>189 CDD:304388 26/104 (25%)
MhpC 78..348 CDD:223669 62/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.