DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and ephx4

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_002662469.1 Gene:ephx4 / 100331939 ZFINID:ZDB-GENE-080227-1 Length:370 Species:Danio rerio


Alignment Length:164 Identity:40/164 - (24%)
Similarity:69/164 - (42%) Gaps:17/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QWIHNRLSIGAQNKEPMD----VRI---DMPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLL 65
            ||....:.....|...:.    |||   .:.:.||..   |.|....:|.|||:.:...:|...|
Zfish    56 QWTVREIPPSCLNDTSLGTHCYVRIKESGLRFHYVAA---GERGKPLMLFLHGFPEFWFSWRHQL 117

  Fly    66 PLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEY-RWQKVSLMAHSMSAMLCFV 129
            ........|:.:|:.|:| .|.||.....:.:|||...::.:.|| .:.:..|:.|....::.::
Zfish   118 REFKSEFRVVAVDMRGYG-ESDLPSSTESYRLDYLVTDIKDIVEYLGYNRCFLVGHDWGGIIAWL 181

  Fly   130 FASLYPHRTDMLVSID----IVKTRYR-KPPSQI 158
            .|..||.....|:.::    .|.|.|. :.|||:
Zfish   182 CAIHYPEMVTKLIVLNSPHPCVFTDYALRHPSQM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 30/119 (25%)
ephx4XP_002662469.1 MhpC 80..354 CDD:223669 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.