Sequence 1: | NP_001138880.1 | Gene: | NONO / 4841 | HGNCID: | 7871 | Length: | 471 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286174.1 | Gene: | nito / 35756 | FlyBaseID: | FBgn0027548 | Length: | 793 | Species: | Drosophila melanogaster |
Alignment Length: | 208 | Identity: | 51/208 - (24%) |
---|---|---|---|
Similarity: | 89/208 - (42%) | Gaps: | 24/208 - (11%) |
- Green bases have known domain annotations that are detailed below.
Human 14 HTPR---------KHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKT 69
Human 70 FTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHK-----DKGFGFIRLETRTLAEIAKVEL 129
Human 130 DNMPLRGKQLRVRF--ACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGI 192
Human 193 VEFSGKPAARKAL 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NONO | NP_001138880.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | 12/45 (27%) | |
DBHS | 54..373 | 38/159 (24%) | |||
RRM1_p54nrb | 73..143 | CDD:410001 | 23/74 (31%) | ||
RRM_SF | 149..228 | CDD:418427 | 13/57 (23%) | ||
NOPS_p54nrb_PSF_PSPC1 | 219..311 | CDD:240581 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 443..471 | ||||
nito | NP_001286174.1 | RRM | <56..>223 | CDD:223796 | |
RRM1_Spen | 98..175 | CDD:240754 | |||
RRM2_Spen | 312..390 | CDD:240755 | 23/78 (29%) | ||
RRM3_Spen | 397..467 | CDD:240756 | 13/56 (23%) | ||
SPOC | 630..789 | CDD:311609 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154205 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |