DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab1 and Lcp65Ag3

DIOPT Version :9

Sequence 1:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:106 Identity:58/106 - (54%)
Similarity:76/106 - (71%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFAMAVARPNLAE--IVRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAA 63
            ||||||||||||:|:|.|...|  |||..|||.||.:..|.|||||.:.:..|.|.:.||:|||.
  Fly     1 MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAI 65

  Fly    64 VVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPVAPVA 104
            .|.||:.::.: .|:.:.:.|:||:||:||:||||||||||
  Fly    66 SVSGSYRFIAD-DGQTYQVNYIADKNGFQPEGAHLPVAPVA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:306811 20/50 (40%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466885
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.