DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab1 and LOC4576733

DIOPT Version :10

Sequence 1:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster
Sequence 2:XP_001237148.2 Gene:LOC4576733 / 4576733 VectorBaseID:AGAMI1_004026 Length:143 Species:Anopheles gambiae


Alignment Length:46 Identity:15/46 - (32%)
Similarity:22/46 - (47%) Gaps:7/46 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VVHGSFTWVDEKTGEKFTITYVAD-ENGYQPQ-----GAHLPVAPV 103
            ||.|.:| :.|..|.:..:.|.:| .||::..     .||.|..||
Mosquito    59 VVKGQYT-LHEADGTERVVDYKSDGHNGFEADVKKVGHAHHPSHPV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:459790 9/27 (33%)
LOC4576733XP_001237148.2 Chitin_bind_4 34..86 CDD:459790 9/27 (33%)

Return to query results.
Submit another query.