DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab1 and Lcp65Ae

DIOPT Version :9

Sequence 1:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:101 Identity:54/101 - (53%)
Similarity:70/101 - (69%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVV 65
            |||||||||:||.|:|  |.|:|:...|||.||.:....|||||.:...:|.||...||:|:..|
  Fly     1 MKFLIVFVAIFAFALA--NEAQIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAV 63

  Fly    66 HGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPVA 101
            .|||.:|.: .|:.:.:.|:|||||:||||||||||
  Fly    64 QGSFRFVAD-DGQTYEVNYIADENGFQPQGAHLPVA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:306811 22/50 (44%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.