DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab1 and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:103 Identity:28/103 - (27%)
Similarity:42/103 - (40%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWV 72
            ||.:|.|........:|:...:.:|.   .....|.|...|..|..|....:.:..||.|.::.:
  Fly    34 VATYAHAPVAVAQKVVVKAAEEYDPH---PQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLI 95

  Fly    73 DEKTGEKFTITYVADE-NGY------QPQGAHLPVAPV 103
            | ..|.|.|:.|.||. ||:      :|....:.||||
  Fly    96 D-ADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:459790 16/51 (31%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 16/52 (31%)

Return to query results.
Submit another query.