DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab1 and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:107 Identity:35/107 - (32%)
Similarity:47/107 - (43%) Gaps:22/107 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSD---GTSIKQEGVLKNAGTDNEAA 63
            |.|...||:..:|||.|         .|..|: :|.....:|   |.|.:||..|.|       .
  Fly    69 KVLAAPVAVAKVAVAEP---------YDPNPQ-YSFSYGVTDHHTGDSKQQEETLVN-------G 116

  Fly    64 VVHGSFTWVDEKTGEKFTITYVADE-NGYQPQGAHLPVAPVA 104
            |||||:: :.|..|....:||.||: ||:........||.||
  Fly   117 VVHGSYS-LAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:459790 19/54 (35%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 20/59 (34%)

Return to query results.
Submit another query.