DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab2 and Cpr73D

DIOPT Version :10

Sequence 1:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster


Alignment Length:89 Identity:23/89 - (25%)
Similarity:43/89 - (48%) Gaps:23/89 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QVSDVEPEK-----WSSDVETSD----GTSIKQEG-----VLKNAGTDNEAA-------VVHGSF 69
            ::|:..|:.     :||.:.||.    |....|.|     .|..:|:|:..|       :|.|::
  Fly   175 EISNAVPDSPSVVAYSSPLYTSHPKARGKMSVQRGPAGSYKLIASGSDHRRAESRAPDGLVRGTY 239

  Fly    70 TWVDEKTGEKFTITYVADEN-GYQ 92
            :::|:| |.:.|:.|:|... ||:
  Fly   240 SFLDDK-GVQRTVEYIAGAGIGYR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:459790 17/67 (25%)
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:459790
Chitin_bind_4 <223..257 CDD:459790 9/34 (26%)
SASA 491..>579 CDD:427409
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.