DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab2 and Lcp65Ad

DIOPT Version :9

Sequence 1:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001261466.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:105 Identity:51/105 - (48%)
Similarity:71/105 - (67%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKF--LIVFVALFAMAVARPNL----AEIVRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTD 59
            |||  .|.|..:.|.::|.|..    |:::|..|||.||.:...||||||.|.::||.||:.|||
  Fly     1 MKFTIAIAFTCILACSLAAPPAIQQDAQVLRFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTD 65

  Fly    60 NEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLP 99
            :||.||.||:.:|.: .|:.::|.|:|||||:||:|||||
  Fly    66 HEAIVVRGSYAYVGD-DGQTYSIQYLADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 27/50 (54%)
Lcp65AdNP_001261466.1 Chitin_bind_4 41..96 CDD:278791 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.