DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ab2 and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:83 Identity:35/83 - (42%)
Similarity:53/83 - (63%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AEIVRQVSDVEPE-KWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITY 84
            |.|::|..|:.|: .:..:.|||:|....:.|.|||.|:..||.|:.||:::.. ..|..:||||
  Fly    41 AVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTG-PDGVVYTITY 104

  Fly    85 VADENGYQPQGAHLPVAP 102
            :||||||:.:|||:|..|
  Fly   105 IADENGYRAEGAHIPTPP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 23/50 (46%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.