powered by:
Protein Alignment Lcp65Ab2 and Cpr12A
DIOPT Version :9
Sequence 1: | NP_788469.1 |
Gene: | Lcp65Ab2 / 48381 |
FlyBaseID: | FBgn0020643 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_572896.1 |
Gene: | Cpr12A / 32309 |
FlyBaseID: | FBgn0030494 |
Length: | 173 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
Similarity: | 27/62 - (43%) |
Gaps: | 6/62 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 ETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTW--VDEKTGEKFTITYVADENGYQPQGAHLP 99
|..|||:..:.|..... .|.:..:|.|.:.: .| |...|:.|.||:.||:...:..|
Fly 51 ELDDGTARYERGYFVKI-NDVKTLMVVGYYAYRMTD---GRYITVFYNADQFGYRQNQSITP 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.