DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k10201 and Zfp511

DIOPT Version :9

Sequence 1:NP_788296.1 Gene:l(2)k10201 / 48373 FlyBaseID:FBgn0016970 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_081477.1 Gene:Zfp511 / 69752 MGIID:1917002 Length:250 Species:Mus musculus


Alignment Length:139 Identity:44/139 - (31%)
Similarity:64/139 - (46%) Gaps:17/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SCVECRKMLPTAHLLDLHITEQHDCYFAASVERGDKPMFSCFLEECTIKFHTARQRKDHCIITHK 139
            :|..|.:..|:.||||:||.|.||..|....:|.|  |:.|.:|.|..||.|::.||||.:..|.
Mouse   108 TCSFCNRAFPSGHLLDVHILEWHDSLFQILAQRQD--MYQCLVESCPEKFKTSQDRKDHMVRLHL 170

  Fly   140 LPANYRFDHSK-NRGKQKHQG-----KSKPNSMEVDEVIEETKSLPYVK---------AFSFGHQ 189
            .||::|||..| |||......     ::..:..:..|:..|..:.|..:         ...||..
Mouse   171 YPADFRFDKPKTNRGPAMPAAADAATRAPTDDSDAMEICSEPAAPPPCRRTYSHRIPSTVCFGQG 235

  Fly   190 TQRSFYTGK 198
            ..|.|.:.|
Mouse   236 AARGFKSTK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k10201NP_788296.1 None
Zfp511NP_081477.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..204 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4173
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8333
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007118
OrthoInspector 1 1.000 - - oto93390
orthoMCL 1 0.900 - - OOG6_105605
Panther 1 1.100 - - LDO PTHR21354
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4629
SonicParanoid 1 1.000 - - X5205
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.680

Return to query results.
Submit another query.