DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k10201 and Zfp511

DIOPT Version :9

Sequence 1:NP_788296.1 Gene:l(2)k10201 / 48373 FlyBaseID:FBgn0016970 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_038963607.1 Gene:Zfp511 / 293586 RGDID:1308585 Length:276 Species:Rattus norvegicus


Alignment Length:82 Identity:36/82 - (43%)
Similarity:50/82 - (60%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SCVECRKMLPTAHLLDLHITEQHDCYFAASVERGDKPMFSCFLEECTIKFHTARQRKDHCIITHK 139
            :|..|.:..|:.||||:||.|.||..|....:|.|  |:.|.:|.|..||.|::.||||.:..|.
  Rat   108 TCSFCNRAFPSGHLLDVHILEWHDSLFQILAQRQD--MYQCLVESCPEKFKTSQDRKDHMVRLHL 170

  Fly   140 LPANYRFDHSK-NRGKQ 155
            .||::|||..| |||::
  Rat   171 YPADFRFDKPKTNRGEK 187



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334266
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4173
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1360267at2759
OrthoFinder 1 1.000 - - FOG0007118
OrthoInspector 1 1.000 - - oto96932
orthoMCL 1 0.900 - - OOG6_105605
Panther 1 1.100 - - LDO PTHR21354
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5205
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.