DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k10201 and ZNF511

DIOPT Version :9

Sequence 1:NP_788296.1 Gene:l(2)k10201 / 48373 FlyBaseID:FBgn0016970 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_665805.2 Gene:ZNF511 / 118472 HGNCID:28445 Length:252 Species:Homo sapiens


Alignment Length:224 Identity:60/224 - (26%)
Similarity:89/224 - (39%) Gaps:63/224 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PAPSLAPFKKLG-------------------------VLVDIDDI--------LGEQDAAAARIR 65
            ||...|||:.:.                         |::.:.|:        ...|.|...::.
Human    27 PAAGAAPFRFVARPVRFPREHQFFEDGDVQRHLYLQDVIMQVADVPEKPRVPAFACQVAGCCQVF 91

  Fly    66 DNIDK-EQSYS------CVECRKMLPTAHLLDLHITEQHDCYFAASVERGDKPMFSCFLEECTIK 123
            |.:|. |..|.      |..|::..|:.||||.||.|.||..|....||.|  |:.|.:|.||.|
Human    92 DALDDYEHHYHTLHGNVCSFCKRAFPSGHLLDAHILEWHDSLFQILSERQD--MYQCLVEGCTEK 154

  Fly   124 FHTARQRKDHCIITHKLPANYRFDH-SKNRGKQKHQG------KSKPNSMEV-DEVIEETKS--- 177
            |.|:|.||||.:..|..||::|||. .|:|.....:.      :|:..:||: .|.:..:.:   
Human   155 FKTSRDRKDHMVRMHLYPADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAG 219

  Fly   178 --------LPYVKAFSFGHQTQRSFYTGK 198
                    :|  ....||....|.|.:.|
Human   220 ERRIYRHRIP--STICFGQGAARGFKSNK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k10201NP_788296.1 None
ZNF511NP_665805.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..221 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4173
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8333
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1360267at2759
OrthoFinder 1 1.000 - - FOG0007118
OrthoInspector 1 1.000 - - oto89819
orthoMCL 1 0.900 - - OOG6_105605
Panther 1 1.100 - - LDO PTHR21354
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4629
SonicParanoid 1 1.000 - - X5205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.690

Return to query results.
Submit another query.